PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19046s0084.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 296aa    MW: 31846.1 Da    PI: 6.7888
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19046s0084.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.28.7e-163191257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          r+R+++++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  Bostr.19046s0084.1.p 31 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 91
                          89*****************99*************************************997 PP

2Wus_type_Homeobox107.39.4e-353093265
     Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                          +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
  Bostr.19046s0084.1.p 30 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 93
                          589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-142398IPR009057Homeodomain-like
PROSITE profilePS5007111.5482792IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.8E-92798IPR009057Homeodomain-like
SMARTSM003891.1E-62996IPR001356Homeobox domain
PfamPF000461.5E-133191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDQEQTLHSP TGHSRSPPSS ASGSTSAEPV RSRWSPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKMLEKF GAVGDANVFY WFQNRRSRSR RRQRQLQAAA AAAAATTNTC DQTMMVSNSL  120
PHHSGSDLGF GGCNTSSNYL FGGSSQVPSF FLGLSSSPPS CSSSYSTSSS ASSSSSYGGG  180
CDNQSNSGMD NLLTMSGQMG YQEANHHHYQ DHSSNVASIL CPSDQNSNFH YQQGVITVFI  240
NGVPTEVTRG GIDMKATFGE DLVLVHSSGV PLPTDEFGFL MHTLQHGEAY FLVPR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATAC0093270.0AC009327.8 Arabidopsis thaliana chromosome III BAC T12J13 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118563.11e-176WUSCHEL related homeobox 11
SwissprotQ6X7J31e-165WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB3H5D31e-176B3H5D3_ARATH; WUSCHEL related homeobox 11
STRINGAT3G03660.21e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.21e-161WUSCHEL related homeobox 11